Anti EFCAB14 pAb (ATL-HPA011224)

Atlas Antibodies

SKU:
ATL-HPA011224-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 14
Gene Name: EFCAB14
Alternative Gene Name: KIAA0494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034210: 72%, ENSRNOG00000010091: 77%
Entrez Gene ID: 9813
Uniprot ID: O75071
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQE
Gene Sequence ESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQE
Gene ID - Mouse ENSMUSG00000034210
Gene ID - Rat ENSRNOG00000010091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EFCAB14 pAb (ATL-HPA011224)
Datasheet Anti EFCAB14 pAb (ATL-HPA011224) Datasheet (External Link)
Vendor Page Anti EFCAB14 pAb (ATL-HPA011224) at Atlas Antibodies

Documents & Links for Anti EFCAB14 pAb (ATL-HPA011224)
Datasheet Anti EFCAB14 pAb (ATL-HPA011224) Datasheet (External Link)
Vendor Page Anti EFCAB14 pAb (ATL-HPA011224)