Anti EFCAB13 pAb (ATL-HPA023249)

Atlas Antibodies

SKU:
ATL-HPA023249-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
  • Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 13
Gene Name: EFCAB13
Alternative Gene Name: C17orf57, FLJ40342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040838: 51%, ENSRNOG00000031284: 24%
Entrez Gene ID: 124989
Uniprot ID: Q8IY85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGGRVSTDDVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLNEITSDRKLSSVAGCYLKYKK
Gene Sequence KGGRVSTDDVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLNEITSDRKLSSVAGCYLKYKK
Gene ID - Mouse ENSMUSG00000040838
Gene ID - Rat ENSRNOG00000031284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EFCAB13 pAb (ATL-HPA023249)
Datasheet Anti EFCAB13 pAb (ATL-HPA023249) Datasheet (External Link)
Vendor Page Anti EFCAB13 pAb (ATL-HPA023249) at Atlas Antibodies

Documents & Links for Anti EFCAB13 pAb (ATL-HPA023249)
Datasheet Anti EFCAB13 pAb (ATL-HPA023249) Datasheet (External Link)
Vendor Page Anti EFCAB13 pAb (ATL-HPA023249)