Anti EFCAB13 pAb (ATL-HPA023249)
Atlas Antibodies
- SKU:
- ATL-HPA023249-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EFCAB13
Alternative Gene Name: C17orf57, FLJ40342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040838: 51%, ENSRNOG00000031284: 24%
Entrez Gene ID: 124989
Uniprot ID: Q8IY85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGGRVSTDDVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLNEITSDRKLSSVAGCYLKYKK |
Gene Sequence | KGGRVSTDDVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLNEITSDRKLSSVAGCYLKYKK |
Gene ID - Mouse | ENSMUSG00000040838 |
Gene ID - Rat | ENSRNOG00000031284 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFCAB13 pAb (ATL-HPA023249) | |
Datasheet | Anti EFCAB13 pAb (ATL-HPA023249) Datasheet (External Link) |
Vendor Page | Anti EFCAB13 pAb (ATL-HPA023249) at Atlas Antibodies |
Documents & Links for Anti EFCAB13 pAb (ATL-HPA023249) | |
Datasheet | Anti EFCAB13 pAb (ATL-HPA023249) Datasheet (External Link) |
Vendor Page | Anti EFCAB13 pAb (ATL-HPA023249) |