Anti EFCAB13 pAb (ATL-HPA021633)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021633-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EFCAB13
Alternative Gene Name: C17orf57, FLJ40342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040838: 50%, ENSRNOG00000007699: 25%
Entrez Gene ID: 124989
Uniprot ID: Q8IY85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TIEKEISPEIRSLSPEYKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAITRE |
| Gene Sequence | TIEKEISPEIRSLSPEYKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAITRE |
| Gene ID - Mouse | ENSMUSG00000040838 |
| Gene ID - Rat | ENSRNOG00000007699 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EFCAB13 pAb (ATL-HPA021633) | |
| Datasheet | Anti EFCAB13 pAb (ATL-HPA021633) Datasheet (External Link) |
| Vendor Page | Anti EFCAB13 pAb (ATL-HPA021633) at Atlas Antibodies |
| Documents & Links for Anti EFCAB13 pAb (ATL-HPA021633) | |
| Datasheet | Anti EFCAB13 pAb (ATL-HPA021633) Datasheet (External Link) |
| Vendor Page | Anti EFCAB13 pAb (ATL-HPA021633) |