Anti EFCAB13 pAb (ATL-HPA021633)

Atlas Antibodies

Catalog No.: ATL-HPA021633-25

Protein Description: EF-hand calcium binding domain 13
Gene Name: EFCAB13
Alternative Gene Name: C17orf57, FLJ40342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040838: 50%, ENSRNOG00000007699: 25%
Entrez Gene ID: 124989
Uniprot ID: Q8IY85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIEKEISPEIRSLSPEYKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAITRE
• Gene Sequence: TIEKEISPEIRSLSPEYKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAITRE
• Gene ID - Mouse: ENSMUSG00000040838
• Gene ID - Rat: ENSRNOG00000007699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.