Anti EFCAB12 pAb (ATL-HPA057532)

Atlas Antibodies

Catalog No.:
ATL-HPA057532-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 12
Gene Name: EFCAB12
Alternative Gene Name: C3orf25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030321: 56%, ENSRNOG00000026176: 56%
Entrez Gene ID: 90288
Uniprot ID: Q6NXP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHL
Gene Sequence DKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHL
Gene ID - Mouse ENSMUSG00000030321
Gene ID - Rat ENSRNOG00000026176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB12 pAb (ATL-HPA057532)
Datasheet Anti EFCAB12 pAb (ATL-HPA057532) Datasheet (External Link)
Vendor Page Anti EFCAB12 pAb (ATL-HPA057532) at Atlas Antibodies

Documents & Links for Anti EFCAB12 pAb (ATL-HPA057532)
Datasheet Anti EFCAB12 pAb (ATL-HPA057532) Datasheet (External Link)
Vendor Page Anti EFCAB12 pAb (ATL-HPA057532)