Anti EFCAB12 pAb (ATL-HPA037694)

Atlas Antibodies

Catalog No.: ATL-HPA037694-25

Protein Description: EF-hand calcium binding domain 12
Gene Name: EFCAB12
Alternative Gene Name: C3orf25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030321: 49%, ENSRNOG00000026176: 52%
Entrez Gene ID: 90288
Uniprot ID: Q6NXP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTT
• Gene Sequence: NPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTT
• Gene ID - Mouse: ENSMUSG00000030321
• Gene ID - Rat: ENSRNOG00000026176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.