Anti EFCAB12 pAb (ATL-HPA037694)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037694-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EFCAB12
Alternative Gene Name: C3orf25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030321: 49%, ENSRNOG00000026176: 52%
Entrez Gene ID: 90288
Uniprot ID: Q6NXP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTT |
Gene Sequence | NPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTT |
Gene ID - Mouse | ENSMUSG00000030321 |
Gene ID - Rat | ENSRNOG00000026176 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFCAB12 pAb (ATL-HPA037694) | |
Datasheet | Anti EFCAB12 pAb (ATL-HPA037694) Datasheet (External Link) |
Vendor Page | Anti EFCAB12 pAb (ATL-HPA037694) at Atlas Antibodies |
Documents & Links for Anti EFCAB12 pAb (ATL-HPA037694) | |
Datasheet | Anti EFCAB12 pAb (ATL-HPA037694) Datasheet (External Link) |
Vendor Page | Anti EFCAB12 pAb (ATL-HPA037694) |