Anti EFCAB11 pAb (ATL-HPA051209)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051209-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EFCAB11
Alternative Gene Name: C14orf143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021176: 80%, ENSRNOG00000053317: 80%
Entrez Gene ID: 90141
Uniprot ID: Q9BUY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS |
| Gene Sequence | MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS |
| Gene ID - Mouse | ENSMUSG00000021176 |
| Gene ID - Rat | ENSRNOG00000053317 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209) | |
| Datasheet | Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link) |
| Vendor Page | Anti EFCAB11 pAb (ATL-HPA051209) at Atlas Antibodies |
| Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209) | |
| Datasheet | Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link) |
| Vendor Page | Anti EFCAB11 pAb (ATL-HPA051209) |