Anti EFCAB11 pAb (ATL-HPA051209)

Atlas Antibodies

Catalog No.:
ATL-HPA051209-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 11
Gene Name: EFCAB11
Alternative Gene Name: C14orf143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021176: 80%, ENSRNOG00000053317: 80%
Entrez Gene ID: 90141
Uniprot ID: Q9BUY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS
Gene Sequence MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS
Gene ID - Mouse ENSMUSG00000021176
Gene ID - Rat ENSRNOG00000053317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209)
Datasheet Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link)
Vendor Page Anti EFCAB11 pAb (ATL-HPA051209) at Atlas Antibodies

Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209)
Datasheet Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link)
Vendor Page Anti EFCAB11 pAb (ATL-HPA051209)