Anti EFCAB10 pAb (ATL-HPA019751)

Atlas Antibodies

Catalog No.:
ATL-HPA019751-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 10
Gene Name: EFCAB10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020562: 72%, ENSRNOG00000010730: 80%
Entrez Gene ID:
Uniprot ID: A6NFE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEIWSAF
Gene Sequence NIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEIWSAF
Gene ID - Mouse ENSMUSG00000020562
Gene ID - Rat ENSRNOG00000010730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB10 pAb (ATL-HPA019751)
Datasheet Anti EFCAB10 pAb (ATL-HPA019751) Datasheet (External Link)
Vendor Page Anti EFCAB10 pAb (ATL-HPA019751) at Atlas Antibodies

Documents & Links for Anti EFCAB10 pAb (ATL-HPA019751)
Datasheet Anti EFCAB10 pAb (ATL-HPA019751) Datasheet (External Link)
Vendor Page Anti EFCAB10 pAb (ATL-HPA019751)