Anti EEFSEC pAb (ATL-HPA035795)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035795-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EEFSEC
Alternative Gene Name: EFSEC, SELB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033216: 78%, ENSRNOG00000012954: 80%
Entrez Gene ID: 60678
Uniprot ID: P57772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKFHITVGHETVMGRLMFFSPAPDNFDQEPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTC |
Gene Sequence | AKFHITVGHETVMGRLMFFSPAPDNFDQEPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTC |
Gene ID - Mouse | ENSMUSG00000033216 |
Gene ID - Rat | ENSRNOG00000012954 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EEFSEC pAb (ATL-HPA035795) | |
Datasheet | Anti EEFSEC pAb (ATL-HPA035795) Datasheet (External Link) |
Vendor Page | Anti EEFSEC pAb (ATL-HPA035795) at Atlas Antibodies |
Documents & Links for Anti EEFSEC pAb (ATL-HPA035795) | |
Datasheet | Anti EEFSEC pAb (ATL-HPA035795) Datasheet (External Link) |
Vendor Page | Anti EEFSEC pAb (ATL-HPA035795) |