Anti EEF1E1 pAb (ATL-HPA057866)

Atlas Antibodies

SKU: ATL-HPA057866-25

• 

Protein Description: eukaryotic translation elongation factor 1 epsilon 1
Gene Name: EEF1E1
Alternative Gene Name: AIMP3, P18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001707: 94%, ENSRNOG00000016390: 96%
Entrez Gene ID: 9521
Uniprot ID: O43324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
• Gene Sequence: GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
• Gene ID - Mouse: ENSMUSG00000001707
• Gene ID - Rat: ENSRNOG00000016390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.