Anti EEF1E1 pAb (ATL-HPA057866)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057866-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EEF1E1
Alternative Gene Name: AIMP3, P18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001707: 94%, ENSRNOG00000016390: 96%
Entrez Gene ID: 9521
Uniprot ID: O43324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Gene Sequence | GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Gene ID - Mouse | ENSMUSG00000001707 |
Gene ID - Rat | ENSRNOG00000016390 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EEF1E1 pAb (ATL-HPA057866) | |
Datasheet | Anti EEF1E1 pAb (ATL-HPA057866) Datasheet (External Link) |
Vendor Page | Anti EEF1E1 pAb (ATL-HPA057866) at Atlas Antibodies |
Documents & Links for Anti EEF1E1 pAb (ATL-HPA057866) | |
Datasheet | Anti EEF1E1 pAb (ATL-HPA057866) Datasheet (External Link) |
Vendor Page | Anti EEF1E1 pAb (ATL-HPA057866) |