Anti EEF1B2 pAb (ATL-HPA035029)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035029-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: EEF1B2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025967: 93%, ENSRNOG00000024186: 91%
Entrez Gene ID: 1933
Uniprot ID: P24534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD |
| Gene Sequence | FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD |
| Gene ID - Mouse | ENSMUSG00000025967 |
| Gene ID - Rat | ENSRNOG00000024186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EEF1B2 pAb (ATL-HPA035029) | |
| Datasheet | Anti EEF1B2 pAb (ATL-HPA035029) Datasheet (External Link) |
| Vendor Page | Anti EEF1B2 pAb (ATL-HPA035029) at Atlas Antibodies |
| Documents & Links for Anti EEF1B2 pAb (ATL-HPA035029) | |
| Datasheet | Anti EEF1B2 pAb (ATL-HPA035029) Datasheet (External Link) |
| Vendor Page | Anti EEF1B2 pAb (ATL-HPA035029) |