Anti EEF1B2 pAb (ATL-HPA035029)

Atlas Antibodies

SKU:
ATL-HPA035029-100
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli fibrillar center & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation elongation factor 1 beta 2
Gene Name: EEF1B2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025967: 93%, ENSRNOG00000024186: 91%
Entrez Gene ID: 1933
Uniprot ID: P24534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD
Gene Sequence FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD
Gene ID - Mouse ENSMUSG00000025967
Gene ID - Rat ENSRNOG00000024186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EEF1B2 pAb (ATL-HPA035029)
Datasheet Anti EEF1B2 pAb (ATL-HPA035029) Datasheet (External Link)
Vendor Page Anti EEF1B2 pAb (ATL-HPA035029) at Atlas Antibodies

Documents & Links for Anti EEF1B2 pAb (ATL-HPA035029)
Datasheet Anti EEF1B2 pAb (ATL-HPA035029) Datasheet (External Link)
Vendor Page Anti EEF1B2 pAb (ATL-HPA035029)