Anti EEF1B2 pAb (ATL-HPA035029)

Atlas Antibodies

Catalog No.: ATL-HPA035029-100

Protein Description: eukaryotic translation elongation factor 1 beta 2
Gene Name: EEF1B2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025967: 93%, ENSRNOG00000024186: 91%
Entrez Gene ID: 1933
Uniprot ID: P24534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD
• Gene Sequence: FGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATD
• Gene ID - Mouse: ENSMUSG00000025967
• Gene ID - Rat: ENSRNOG00000024186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.