Anti EEF1AKMT1 pAb (ATL-HPA042543)

Atlas Antibodies

SKU: ATL-HPA042543-25

• 

Protein Description: eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1
Gene Name: EEF1AKMT1
Alternative Gene Name: N6AMT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021951: 86%, ENSRNOG00000009849: 85%
Entrez Gene ID: 221143
Uniprot ID: Q8WVE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPY
• Gene Sequence: GEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPY
• Gene ID - Mouse: ENSMUSG00000021951
• Gene ID - Rat: ENSRNOG00000009849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.