Anti EEF1AKMT1 pAb (ATL-HPA042543)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042543-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EEF1AKMT1
Alternative Gene Name: N6AMT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021951: 86%, ENSRNOG00000009849: 85%
Entrez Gene ID: 221143
Uniprot ID: Q8WVE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPY |
Gene Sequence | GEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPY |
Gene ID - Mouse | ENSMUSG00000021951 |
Gene ID - Rat | ENSRNOG00000009849 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EEF1AKMT1 pAb (ATL-HPA042543) | |
Datasheet | Anti EEF1AKMT1 pAb (ATL-HPA042543) Datasheet (External Link) |
Vendor Page | Anti EEF1AKMT1 pAb (ATL-HPA042543) at Atlas Antibodies |
Documents & Links for Anti EEF1AKMT1 pAb (ATL-HPA042543) | |
Datasheet | Anti EEF1AKMT1 pAb (ATL-HPA042543) Datasheet (External Link) |
Vendor Page | Anti EEF1AKMT1 pAb (ATL-HPA042543) |