Anti EEF1A1 pAb (ATL-HPA056990)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056990-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EEF1A1
Alternative Gene Name: EE1A1, EEF1A, EF1A, LENG7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016349: 100%, ENSRNOG00000012477: 100%
Entrez Gene ID: 1915
Uniprot ID: P68104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR |
Gene Sequence | PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR |
Gene ID - Mouse | ENSMUSG00000016349 |
Gene ID - Rat | ENSRNOG00000012477 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EEF1A1 pAb (ATL-HPA056990) | |
Datasheet | Anti EEF1A1 pAb (ATL-HPA056990) Datasheet (External Link) |
Vendor Page | Anti EEF1A1 pAb (ATL-HPA056990) at Atlas Antibodies |
Documents & Links for Anti EEF1A1 pAb (ATL-HPA056990) | |
Datasheet | Anti EEF1A1 pAb (ATL-HPA056990) Datasheet (External Link) |
Vendor Page | Anti EEF1A1 pAb (ATL-HPA056990) |