Anti EEF1A1 pAb (ATL-HPA056990)

Atlas Antibodies

Catalog No.:
ATL-HPA056990-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation elongation factor 1 alpha 1
Gene Name: EEF1A1
Alternative Gene Name: EE1A1, EEF1A, EF1A, LENG7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016349: 100%, ENSRNOG00000012477: 100%
Entrez Gene ID: 1915
Uniprot ID: P68104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR
Gene Sequence PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR
Gene ID - Mouse ENSMUSG00000016349
Gene ID - Rat ENSRNOG00000012477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EEF1A1 pAb (ATL-HPA056990)
Datasheet Anti EEF1A1 pAb (ATL-HPA056990) Datasheet (External Link)
Vendor Page Anti EEF1A1 pAb (ATL-HPA056990) at Atlas Antibodies

Documents & Links for Anti EEF1A1 pAb (ATL-HPA056990)
Datasheet Anti EEF1A1 pAb (ATL-HPA056990) Datasheet (External Link)
Vendor Page Anti EEF1A1 pAb (ATL-HPA056990)