Anti EED pAb (ATL-HPA061140 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061140-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: embryonic ectoderm development
Gene Name: EED
Alternative Gene Name: HEED, WAIT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030619: 100%, ENSRNOG00000017509: 100%
Entrez Gene ID: 8726
Uniprot ID: O75530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK
Gene Sequence HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK
Gene ID - Mouse ENSMUSG00000030619
Gene ID - Rat ENSRNOG00000017509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EED pAb (ATL-HPA061140 w/enhanced validation)
Datasheet Anti EED pAb (ATL-HPA061140 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EED pAb (ATL-HPA061140 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EED pAb (ATL-HPA061140 w/enhanced validation)
Datasheet Anti EED pAb (ATL-HPA061140 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EED pAb (ATL-HPA061140 w/enhanced validation)
Citations for Anti EED pAb (ATL-HPA061140 w/enhanced validation) – 2 Found
Zhu, Junyu; Li, Lili; Tong, Joanna; Hui, Connie; Wong, Chi Hang; Lo, Kwok Wai; Chan, Raymond; Ai, Qi Yong; Hui, Edwin P; Chan, Anthony Tc; To, Ka F; Tao, Qian; Ma, Brigette By. Targeting the polycomb repressive complex-2 related proteins with novel combinational strategies for nasopharyngeal carcinoma. American Journal Of Cancer Research. 10(10):3267-3284.  PubMed
Bremer, Sebastian C B; Bittner, Gabi; Elakad, Omar; Dinter, Helen; Gaedcke, Jochen; König, Alexander O; Amanzada, Ahmad; Ellenrieder, Volker; Freiherr von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Enhancer of Zeste Homolog 2 (EZH2) Is a Marker of High-Grade Neuroendocrine Neoplasia in Gastroenteropancreatic and Pulmonary Tract and Predicts Poor Prognosis. Cancers. 2022;14(12)  PubMed