Anti EED pAb (ATL-HPA061140 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061140-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EED
Alternative Gene Name: HEED, WAIT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030619: 100%, ENSRNOG00000017509: 100%
Entrez Gene ID: 8726
Uniprot ID: O75530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK |
| Gene Sequence | HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK |
| Gene ID - Mouse | ENSMUSG00000030619 |
| Gene ID - Rat | ENSRNOG00000017509 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EED pAb (ATL-HPA061140 w/enhanced validation) | |
| Datasheet | Anti EED pAb (ATL-HPA061140 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EED pAb (ATL-HPA061140 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EED pAb (ATL-HPA061140 w/enhanced validation) | |
| Datasheet | Anti EED pAb (ATL-HPA061140 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EED pAb (ATL-HPA061140 w/enhanced validation) |
| Citations for Anti EED pAb (ATL-HPA061140 w/enhanced validation) – 2 Found |
| Zhu, Junyu; Li, Lili; Tong, Joanna; Hui, Connie; Wong, Chi Hang; Lo, Kwok Wai; Chan, Raymond; Ai, Qi Yong; Hui, Edwin P; Chan, Anthony Tc; To, Ka F; Tao, Qian; Ma, Brigette By. Targeting the polycomb repressive complex-2 related proteins with novel combinational strategies for nasopharyngeal carcinoma. American Journal Of Cancer Research. 10(10):3267-3284. PubMed |
| Bremer, Sebastian C B; Bittner, Gabi; Elakad, Omar; Dinter, Helen; Gaedcke, Jochen; König, Alexander O; Amanzada, Ahmad; Ellenrieder, Volker; Freiherr von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Enhancer of Zeste Homolog 2 (EZH2) Is a Marker of High-Grade Neuroendocrine Neoplasia in Gastroenteropancreatic and Pulmonary Tract and Predicts Poor Prognosis. Cancers. 2022;14(12) PubMed |