Anti EEA1 pAb (ATL-HPA038158)

Atlas Antibodies

Catalog No.:
ATL-HPA038158-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: early endosome antigen 1
Gene Name: EEA1
Alternative Gene Name: ZFYVE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036499: 81%, ENSRNOG00000021681: 77%
Entrez Gene ID: 8411
Uniprot ID: Q15075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERC
Gene Sequence QETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERC
Gene ID - Mouse ENSMUSG00000036499
Gene ID - Rat ENSRNOG00000021681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EEA1 pAb (ATL-HPA038158)
Datasheet Anti EEA1 pAb (ATL-HPA038158) Datasheet (External Link)
Vendor Page Anti EEA1 pAb (ATL-HPA038158) at Atlas Antibodies

Documents & Links for Anti EEA1 pAb (ATL-HPA038158)
Datasheet Anti EEA1 pAb (ATL-HPA038158) Datasheet (External Link)
Vendor Page Anti EEA1 pAb (ATL-HPA038158)