Anti EDN2 pAb (ATL-HPA028459)

Atlas Antibodies

SKU:
ATL-HPA028459-25
  • Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and EDN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419628).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: endothelin 2
Gene Name: EDN2
Alternative Gene Name: ET2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028635: 53%, ENSRNOG00000009390: 54%
Entrez Gene ID: 1907
Uniprot ID: P20800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR
Gene Sequence LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR
Gene ID - Mouse ENSMUSG00000028635
Gene ID - Rat ENSRNOG00000009390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDN2 pAb (ATL-HPA028459)
Datasheet Anti EDN2 pAb (ATL-HPA028459) Datasheet (External Link)
Vendor Page Anti EDN2 pAb (ATL-HPA028459) at Atlas Antibodies

Documents & Links for Anti EDN2 pAb (ATL-HPA028459)
Datasheet Anti EDN2 pAb (ATL-HPA028459) Datasheet (External Link)
Vendor Page Anti EDN2 pAb (ATL-HPA028459)