Anti EDN1 pAb (ATL-HPA031976)

Atlas Antibodies

SKU:
ATL-HPA031976-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells and endothelial cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus.
  • Western blot analysis in human plasma.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: endothelin 1
Gene Name: EDN1
Alternative Gene Name: ET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021367: 69%, ENSRNOG00000014361: 71%
Entrez Gene ID: 1906
Uniprot ID: P05305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH
Gene Sequence PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH
Gene ID - Mouse ENSMUSG00000021367
Gene ID - Rat ENSRNOG00000014361
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDN1 pAb (ATL-HPA031976)
Datasheet Anti EDN1 pAb (ATL-HPA031976) Datasheet (External Link)
Vendor Page Anti EDN1 pAb (ATL-HPA031976) at Atlas Antibodies

Documents & Links for Anti EDN1 pAb (ATL-HPA031976)
Datasheet Anti EDN1 pAb (ATL-HPA031976) Datasheet (External Link)
Vendor Page Anti EDN1 pAb (ATL-HPA031976)