Anti EDN1 pAb (ATL-HPA031976)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031976-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: EDN1
Alternative Gene Name: ET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021367: 69%, ENSRNOG00000014361: 71%
Entrez Gene ID: 1906
Uniprot ID: P05305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH |
| Gene Sequence | PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH |
| Gene ID - Mouse | ENSMUSG00000021367 |
| Gene ID - Rat | ENSRNOG00000014361 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EDN1 pAb (ATL-HPA031976) | |
| Datasheet | Anti EDN1 pAb (ATL-HPA031976) Datasheet (External Link) |
| Vendor Page | Anti EDN1 pAb (ATL-HPA031976) at Atlas Antibodies |
| Documents & Links for Anti EDN1 pAb (ATL-HPA031976) | |
| Datasheet | Anti EDN1 pAb (ATL-HPA031976) Datasheet (External Link) |
| Vendor Page | Anti EDN1 pAb (ATL-HPA031976) |