Anti EDF1 pAb (ATL-HPA035642)

Atlas Antibodies

SKU: ATL-HPA035642-25

• 
• 
• 

Protein Description: endothelial differentiation-related factor 1
Gene Name: EDF1
Alternative Gene Name: EDF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015092: 99%, ENSRNOG00000016272: 99%
Entrez Gene ID: 8721
Uniprot ID: O60869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIE
• Gene Sequence: KLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIE
• Gene ID - Mouse: ENSMUSG00000015092
• Gene ID - Rat: ENSRNOG00000016272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.