Anti EDEM3 pAb (ATL-HPA025754)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025754-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EDEM3
Alternative Gene Name: C1orf22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043019: 99%, ENSRNOG00000028358: 98%
Entrez Gene ID: 80267
Uniprot ID: Q9BZQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL |
Gene Sequence | YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL |
Gene ID - Mouse | ENSMUSG00000043019 |
Gene ID - Rat | ENSRNOG00000028358 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EDEM3 pAb (ATL-HPA025754) | |
Datasheet | Anti EDEM3 pAb (ATL-HPA025754) Datasheet (External Link) |
Vendor Page | Anti EDEM3 pAb (ATL-HPA025754) at Atlas Antibodies |
Documents & Links for Anti EDEM3 pAb (ATL-HPA025754) | |
Datasheet | Anti EDEM3 pAb (ATL-HPA025754) Datasheet (External Link) |
Vendor Page | Anti EDEM3 pAb (ATL-HPA025754) |