Anti EDEM3 pAb (ATL-HPA025754)

Atlas Antibodies

Catalog No.:
ATL-HPA025754-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ER degradation enhancer, mannosidase alpha-like 3
Gene Name: EDEM3
Alternative Gene Name: C1orf22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043019: 99%, ENSRNOG00000028358: 98%
Entrez Gene ID: 80267
Uniprot ID: Q9BZQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL
Gene Sequence YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL
Gene ID - Mouse ENSMUSG00000043019
Gene ID - Rat ENSRNOG00000028358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EDEM3 pAb (ATL-HPA025754)
Datasheet Anti EDEM3 pAb (ATL-HPA025754) Datasheet (External Link)
Vendor Page Anti EDEM3 pAb (ATL-HPA025754) at Atlas Antibodies

Documents & Links for Anti EDEM3 pAb (ATL-HPA025754)
Datasheet Anti EDEM3 pAb (ATL-HPA025754) Datasheet (External Link)
Vendor Page Anti EDEM3 pAb (ATL-HPA025754)