Anti EDC4 pAb (ATL-HPA041164)

Atlas Antibodies

SKU:
ATL-HPA041164-100
  • Immunohistochemical staining of human Lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytoplasmic bodies.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: enhancer of mRNA decapping 4
Gene Name: EDC4
Alternative Gene Name: Ge-1, HEDLS, RCD-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036270: 98%, ENSRNOG00000024025: 99%
Entrez Gene ID: 23644
Uniprot ID: Q6P2E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDA
Gene Sequence VERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDA
Gene ID - Mouse ENSMUSG00000036270
Gene ID - Rat ENSRNOG00000024025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDC4 pAb (ATL-HPA041164)
Datasheet Anti EDC4 pAb (ATL-HPA041164) Datasheet (External Link)
Vendor Page Anti EDC4 pAb (ATL-HPA041164) at Atlas Antibodies

Documents & Links for Anti EDC4 pAb (ATL-HPA041164)
Datasheet Anti EDC4 pAb (ATL-HPA041164) Datasheet (External Link)
Vendor Page Anti EDC4 pAb (ATL-HPA041164)