Anti EDC3 pAb (ATL-HPA044206)

Atlas Antibodies

SKU:
ATL-HPA044206-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in renal tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: enhancer of mRNA decapping 3
Gene Name: EDC3
Alternative Gene Name: FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038957: 98%, ENSRNOG00000019579: 97%
Entrez Gene ID: 80153
Uniprot ID: Q96F86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL
Gene Sequence LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL
Gene ID - Mouse ENSMUSG00000038957
Gene ID - Rat ENSRNOG00000019579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDC3 pAb (ATL-HPA044206)
Datasheet Anti EDC3 pAb (ATL-HPA044206) Datasheet (External Link)
Vendor Page Anti EDC3 pAb (ATL-HPA044206) at Atlas Antibodies

Documents & Links for Anti EDC3 pAb (ATL-HPA044206)
Datasheet Anti EDC3 pAb (ATL-HPA044206) Datasheet (External Link)
Vendor Page Anti EDC3 pAb (ATL-HPA044206)