Anti EDA2R pAb (ATL-HPA054522)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054522-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EDA2R
Alternative Gene Name: EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034457: 86%, ENSRNOG00000013018: 88%
Entrez Gene ID: 60401
Uniprot ID: Q9HAV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS |
Gene Sequence | CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS |
Gene ID - Mouse | ENSMUSG00000034457 |
Gene ID - Rat | ENSRNOG00000013018 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EDA2R pAb (ATL-HPA054522) | |
Datasheet | Anti EDA2R pAb (ATL-HPA054522) Datasheet (External Link) |
Vendor Page | Anti EDA2R pAb (ATL-HPA054522) at Atlas Antibodies |
Documents & Links for Anti EDA2R pAb (ATL-HPA054522) | |
Datasheet | Anti EDA2R pAb (ATL-HPA054522) Datasheet (External Link) |
Vendor Page | Anti EDA2R pAb (ATL-HPA054522) |