Anti EDA2R pAb (ATL-HPA054522)

Atlas Antibodies

Catalog No.:
ATL-HPA054522-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ectodysplasin A2 receptor
Gene Name: EDA2R
Alternative Gene Name: EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034457: 86%, ENSRNOG00000013018: 88%
Entrez Gene ID: 60401
Uniprot ID: Q9HAV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS
Gene Sequence CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS
Gene ID - Mouse ENSMUSG00000034457
Gene ID - Rat ENSRNOG00000013018
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EDA2R pAb (ATL-HPA054522)
Datasheet Anti EDA2R pAb (ATL-HPA054522) Datasheet (External Link)
Vendor Page Anti EDA2R pAb (ATL-HPA054522) at Atlas Antibodies

Documents & Links for Anti EDA2R pAb (ATL-HPA054522)
Datasheet Anti EDA2R pAb (ATL-HPA054522) Datasheet (External Link)
Vendor Page Anti EDA2R pAb (ATL-HPA054522)