Anti ECT2L pAb (ATL-HPA035488)

Atlas Antibodies

Catalog No.:
ATL-HPA035488-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: epithelial cell transforming 2 like
Gene Name: ECT2L
Alternative Gene Name: ARHGEF32, C6orf91, FBXO49, LFDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071392: 85%, ENSRNOG00000055142: 81%
Entrez Gene ID: 345930
Uniprot ID: Q008S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
Gene Sequence GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
Gene ID - Mouse ENSMUSG00000071392
Gene ID - Rat ENSRNOG00000055142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECT2L pAb (ATL-HPA035488)
Datasheet Anti ECT2L pAb (ATL-HPA035488) Datasheet (External Link)
Vendor Page Anti ECT2L pAb (ATL-HPA035488) at Atlas Antibodies

Documents & Links for Anti ECT2L pAb (ATL-HPA035488)
Datasheet Anti ECT2L pAb (ATL-HPA035488) Datasheet (External Link)
Vendor Page Anti ECT2L pAb (ATL-HPA035488)