Anti ECT2L pAb (ATL-HPA035488)

Atlas Antibodies

Catalog No.: ATL-HPA035488-25

Protein Description: epithelial cell transforming 2 like
Gene Name: ECT2L
Alternative Gene Name: ARHGEF32, C6orf91, FBXO49, LFDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071392: 85%, ENSRNOG00000055142: 81%
Entrez Gene ID: 345930
Uniprot ID: Q008S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
• Gene Sequence: GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
• Gene ID - Mouse: ENSMUSG00000071392
• Gene ID - Rat: ENSRNOG00000055142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.