Anti ECT2 pAb (ATL-HPA053261)

Atlas Antibodies

Catalog No.:
ATL-HPA053261-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: epithelial cell transforming 2
Gene Name: ECT2
Alternative Gene Name: ARHGEF31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027699: 94%, ENSRNOG00000024365: 95%
Entrez Gene ID: 1894
Uniprot ID: Q9H8V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKET
Gene Sequence IIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKET
Gene ID - Mouse ENSMUSG00000027699
Gene ID - Rat ENSRNOG00000024365
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECT2 pAb (ATL-HPA053261)
Datasheet Anti ECT2 pAb (ATL-HPA053261) Datasheet (External Link)
Vendor Page Anti ECT2 pAb (ATL-HPA053261) at Atlas Antibodies

Documents & Links for Anti ECT2 pAb (ATL-HPA053261)
Datasheet Anti ECT2 pAb (ATL-HPA053261) Datasheet (External Link)
Vendor Page Anti ECT2 pAb (ATL-HPA053261)