Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021995-25
  • Immunohistochemical staining of human gastrointestinal, heart muscle, kidney and liver using Anti-ECHS1 antibody HPA021995 (A) shows similar protein distribution across tissues to independent antibody HPA022476 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
  • Western blot analysis using Anti-ECHS1 antibody HPA021995 (A) shows similar pattern to independent antibody HPA022476 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enoyl CoA hydratase, short chain, 1, mitochondrial
Gene Name: ECHS1
Alternative Gene Name: SCEH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025465: 86%, ENSRNOG00000047565: 85%
Entrez Gene ID: 1892
Uniprot ID: P30084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMM
Gene Sequence ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMM
Gene ID - Mouse ENSMUSG00000025465
Gene ID - Rat ENSRNOG00000047565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation)
Datasheet Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation)
Datasheet Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ECHS1 pAb (ATL-HPA021995 w/enhanced validation)