Anti ECHDC3 pAb (ATL-HPA038306 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038306-25

Protein Description: enoyl CoA hydratase domain containing 3
Gene Name: ECHDC3
Alternative Gene Name: FLJ20909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039063: 82%, ENSRNOG00000048114: 81%
Entrez Gene ID: 79746
Uniprot ID: Q96DC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
• Gene Sequence: FTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
• Gene ID - Mouse: ENSMUSG00000039063
• Gene ID - Rat: ENSRNOG00000048114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.