Anti ECHDC3 pAb (ATL-HPA038306 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038306-25
  • Immunohistochemistry analysis in human kidney and cerebral cortex tissues using Anti-ECHDC3 antibody. Corresponding ECHDC3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nucleoli & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enoyl CoA hydratase domain containing 3
Gene Name: ECHDC3
Alternative Gene Name: FLJ20909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039063: 82%, ENSRNOG00000048114: 81%
Entrez Gene ID: 79746
Uniprot ID: Q96DC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
Gene Sequence FTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
Gene ID - Mouse ENSMUSG00000039063
Gene ID - Rat ENSRNOG00000048114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ECHDC3 pAb (ATL-HPA038306 w/enhanced validation)
Datasheet Anti ECHDC3 pAb (ATL-HPA038306 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ECHDC3 pAb (ATL-HPA038306 w/enhanced validation)