Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026768-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: enoyl CoA hydratase domain containing 2
Gene Name: ECHDC2
Alternative Gene Name: FLJ10948
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028601: 87%, ENSRNOG00000029333: 90%
Entrez Gene ID: 55268
Uniprot ID: Q86YB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGM
Gene Sequence LIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGM
Gene ID - Mouse ENSMUSG00000028601
Gene ID - Rat ENSRNOG00000029333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation)
Datasheet Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation)
Datasheet Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation)
Citations for Anti ECHDC2 pAb (ATL-HPA026768 w/enhanced validation) – 1 Found
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed