Anti ECHDC1 pAb (ATL-HPA035446)

Atlas Antibodies

Catalog No.:
ATL-HPA035446-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ethylmalonyl-CoA decarboxylase 1
Gene Name: ECHDC1
Alternative Gene Name: dJ351K20.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019883: 86%, ENSRNOG00000011622: 86%
Entrez Gene ID: 55862
Uniprot ID: Q9NTX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLI
Gene Sequence SGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLI
Gene ID - Mouse ENSMUSG00000019883
Gene ID - Rat ENSRNOG00000011622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECHDC1 pAb (ATL-HPA035446)
Datasheet Anti ECHDC1 pAb (ATL-HPA035446) Datasheet (External Link)
Vendor Page Anti ECHDC1 pAb (ATL-HPA035446) at Atlas Antibodies

Documents & Links for Anti ECHDC1 pAb (ATL-HPA035446)
Datasheet Anti ECHDC1 pAb (ATL-HPA035446) Datasheet (External Link)
Vendor Page Anti ECHDC1 pAb (ATL-HPA035446)