Anti ECH1 pAb (ATL-HPA005835)

Atlas Antibodies

Catalog No.:
ATL-HPA005835-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: enoyl CoA hydratase 1, peroxisomal
Gene Name: ECH1
Alternative Gene Name: HPXEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053898: 78%, ENSRNOG00000020308: 81%
Entrez Gene ID: 1891
Uniprot ID: Q13011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Gene Sequence EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Gene ID - Mouse ENSMUSG00000053898
Gene ID - Rat ENSRNOG00000020308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECH1 pAb (ATL-HPA005835)
Datasheet Anti ECH1 pAb (ATL-HPA005835) Datasheet (External Link)
Vendor Page Anti ECH1 pAb (ATL-HPA005835) at Atlas Antibodies

Documents & Links for Anti ECH1 pAb (ATL-HPA005835)
Datasheet Anti ECH1 pAb (ATL-HPA005835) Datasheet (External Link)
Vendor Page Anti ECH1 pAb (ATL-HPA005835)
Citations for Anti ECH1 pAb (ATL-HPA005835) – 2 Found
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed