Anti ECH1 pAb (ATL-HPA005835)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005835-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ECH1
Alternative Gene Name: HPXEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053898: 78%, ENSRNOG00000020308: 81%
Entrez Gene ID: 1891
Uniprot ID: Q13011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF |
| Gene Sequence | EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF |
| Gene ID - Mouse | ENSMUSG00000053898 |
| Gene ID - Rat | ENSRNOG00000020308 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ECH1 pAb (ATL-HPA005835) | |
| Datasheet | Anti ECH1 pAb (ATL-HPA005835) Datasheet (External Link) |
| Vendor Page | Anti ECH1 pAb (ATL-HPA005835) at Atlas Antibodies |
| Documents & Links for Anti ECH1 pAb (ATL-HPA005835) | |
| Datasheet | Anti ECH1 pAb (ATL-HPA005835) Datasheet (External Link) |
| Vendor Page | Anti ECH1 pAb (ATL-HPA005835) |
| Citations for Anti ECH1 pAb (ATL-HPA005835) – 2 Found |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |