Anti ECH1 pAb (ATL-HPA002907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002907-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ECH1
Alternative Gene Name: HPXEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053898: 74%, ENSRNOG00000020308: 75%
Entrez Gene ID: 1891
Uniprot ID: Q13011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPK |
| Gene Sequence | ISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPK |
| Gene ID - Mouse | ENSMUSG00000053898 |
| Gene ID - Rat | ENSRNOG00000020308 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ECH1 pAb (ATL-HPA002907) | |
| Datasheet | Anti ECH1 pAb (ATL-HPA002907) Datasheet (External Link) |
| Vendor Page | Anti ECH1 pAb (ATL-HPA002907) at Atlas Antibodies |
| Documents & Links for Anti ECH1 pAb (ATL-HPA002907) | |
| Datasheet | Anti ECH1 pAb (ATL-HPA002907) Datasheet (External Link) |
| Vendor Page | Anti ECH1 pAb (ATL-HPA002907) |
| Citations for Anti ECH1 pAb (ATL-HPA002907) – 1 Found |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |