Anti ECEL1 pAb (ATL-HPA077424)

Atlas Antibodies

Catalog No.:
ATL-HPA077424-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: endothelin converting enzyme like 1
Gene Name: ECEL1
Alternative Gene Name: DINE, XCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026247: 91%, ENSRNOG00000019447: 90%
Entrez Gene ID: 9427
Uniprot ID: O95672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR
Gene Sequence LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR
Gene ID - Mouse ENSMUSG00000026247
Gene ID - Rat ENSRNOG00000019447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECEL1 pAb (ATL-HPA077424)
Datasheet Anti ECEL1 pAb (ATL-HPA077424) Datasheet (External Link)
Vendor Page Anti ECEL1 pAb (ATL-HPA077424) at Atlas Antibodies

Documents & Links for Anti ECEL1 pAb (ATL-HPA077424)
Datasheet Anti ECEL1 pAb (ATL-HPA077424) Datasheet (External Link)
Vendor Page Anti ECEL1 pAb (ATL-HPA077424)