Anti ECEL1 pAb (ATL-HPA077424)

Atlas Antibodies

Catalog No.: ATL-HPA077424-25

Protein Description: endothelin converting enzyme like 1
Gene Name: ECEL1
Alternative Gene Name: DINE, XCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026247: 91%, ENSRNOG00000019447: 90%
Entrez Gene ID: 9427
Uniprot ID: O95672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR
• Gene Sequence: LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR
• Gene ID - Mouse: ENSMUSG00000026247
• Gene ID - Rat: ENSRNOG00000019447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.