Anti ECE2 pAb (ATL-HPA062215)

Atlas Antibodies

Catalog No.:
ATL-HPA062215-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: endothelin converting enzyme 2
Gene Name: ECE2
Alternative Gene Name: KIAA0604, MGC2408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022842: 88%, ENSRNOG00000029529: 87%
Entrez Gene ID: 9718
Uniprot ID: O60344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD
Gene Sequence REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD
Gene ID - Mouse ENSMUSG00000022842
Gene ID - Rat ENSRNOG00000029529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ECE2 pAb (ATL-HPA062215)
Datasheet Anti ECE2 pAb (ATL-HPA062215) Datasheet (External Link)
Vendor Page Anti ECE2 pAb (ATL-HPA062215) at Atlas Antibodies

Documents & Links for Anti ECE2 pAb (ATL-HPA062215)
Datasheet Anti ECE2 pAb (ATL-HPA062215) Datasheet (External Link)
Vendor Page Anti ECE2 pAb (ATL-HPA062215)