Anti ECE2 pAb (ATL-HPA062215)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062215-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ECE2
Alternative Gene Name: KIAA0604, MGC2408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022842: 88%, ENSRNOG00000029529: 87%
Entrez Gene ID: 9718
Uniprot ID: O60344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD |
| Gene Sequence | REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD |
| Gene ID - Mouse | ENSMUSG00000022842 |
| Gene ID - Rat | ENSRNOG00000029529 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ECE2 pAb (ATL-HPA062215) | |
| Datasheet | Anti ECE2 pAb (ATL-HPA062215) Datasheet (External Link) |
| Vendor Page | Anti ECE2 pAb (ATL-HPA062215) at Atlas Antibodies |
| Documents & Links for Anti ECE2 pAb (ATL-HPA062215) | |
| Datasheet | Anti ECE2 pAb (ATL-HPA062215) Datasheet (External Link) |
| Vendor Page | Anti ECE2 pAb (ATL-HPA062215) |