Anti ECE1 pAb (ATL-HPA001490)

Atlas Antibodies

SKU:
ATL-HPA001490-100
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line U-87 MG
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: endothelin converting enzyme 1
Gene Name: ECE1
Alternative Gene Name: ECE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057530: 98%, ENSRNOG00000014241: 98%
Entrez Gene ID: 1889
Uniprot ID: P42892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKR
Gene Sequence IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKR
Gene ID - Mouse ENSMUSG00000057530
Gene ID - Rat ENSRNOG00000014241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ECE1 pAb (ATL-HPA001490)
Datasheet Anti ECE1 pAb (ATL-HPA001490) Datasheet (External Link)
Vendor Page Anti ECE1 pAb (ATL-HPA001490) at Atlas Antibodies

Documents & Links for Anti ECE1 pAb (ATL-HPA001490)
Datasheet Anti ECE1 pAb (ATL-HPA001490) Datasheet (External Link)
Vendor Page Anti ECE1 pAb (ATL-HPA001490)