Anti EBP pAb (ATL-HPA003130)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003130-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EBP
Alternative Gene Name: CDPX2, CHO2, CPX, CPXD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031168: 77%, ENSRNOG00000004903: 81%
Entrez Gene ID: 10682
Uniprot ID: Q15125
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF |
Gene Sequence | YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF |
Gene ID - Mouse | ENSMUSG00000031168 |
Gene ID - Rat | ENSRNOG00000004903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EBP pAb (ATL-HPA003130) | |
Datasheet | Anti EBP pAb (ATL-HPA003130) Datasheet (External Link) |
Vendor Page | Anti EBP pAb (ATL-HPA003130) at Atlas Antibodies |
Documents & Links for Anti EBP pAb (ATL-HPA003130) | |
Datasheet | Anti EBP pAb (ATL-HPA003130) Datasheet (External Link) |
Vendor Page | Anti EBP pAb (ATL-HPA003130) |