Anti EBP pAb (ATL-HPA003130)

Atlas Antibodies

SKU: ATL-HPA003130-25

• 
• 

Protein Description: emopamil binding protein (sterol isomerase)
Gene Name: EBP
Alternative Gene Name: CDPX2, CHO2, CPX, CPXD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031168: 77%, ENSRNOG00000004903: 81%
Entrez Gene ID: 10682
Uniprot ID: Q15125
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
• Gene Sequence: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
• Gene ID - Mouse: ENSMUSG00000031168
• Gene ID - Rat: ENSRNOG00000004903
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.