Anti EBNA1BP2 pAb (ATL-HPA026512)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026512-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EBNA1BP2
Alternative Gene Name: EBP2, NOBP, P40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028729: 79%, ENSRNOG00000050287: 80%
Entrez Gene ID: 10969
Uniprot ID: Q99848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDD |
| Gene Sequence | ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDD |
| Gene ID - Mouse | ENSMUSG00000028729 |
| Gene ID - Rat | ENSRNOG00000050287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EBNA1BP2 pAb (ATL-HPA026512) | |
| Datasheet | Anti EBNA1BP2 pAb (ATL-HPA026512) Datasheet (External Link) |
| Vendor Page | Anti EBNA1BP2 pAb (ATL-HPA026512) at Atlas Antibodies |
| Documents & Links for Anti EBNA1BP2 pAb (ATL-HPA026512) | |
| Datasheet | Anti EBNA1BP2 pAb (ATL-HPA026512) Datasheet (External Link) |
| Vendor Page | Anti EBNA1BP2 pAb (ATL-HPA026512) |
| Citations for Anti EBNA1BP2 pAb (ATL-HPA026512) – 1 Found |
| Kampf, Caroline; Bergman, Julia; Oksvold, Per; Asplund, Anna; Navani, Sanjay; Wiking, Mikaela; Lundberg, Emma; Uhlén, Mathias; Ponten, Fredrik. A tool to facilitate clinical biomarker studies--a tissue dictionary based on the Human Protein Atlas. Bmc Medicine. 2012;10( 22971420):103. PubMed |