Anti EBNA1BP2 pAb (ATL-HPA026512)

Atlas Antibodies

Catalog No.:
ATL-HPA026512-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EBNA1 binding protein 2
Gene Name: EBNA1BP2
Alternative Gene Name: EBP2, NOBP, P40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028729: 79%, ENSRNOG00000050287: 80%
Entrez Gene ID: 10969
Uniprot ID: Q99848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDD
Gene Sequence ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDD
Gene ID - Mouse ENSMUSG00000028729
Gene ID - Rat ENSRNOG00000050287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EBNA1BP2 pAb (ATL-HPA026512)
Datasheet Anti EBNA1BP2 pAb (ATL-HPA026512) Datasheet (External Link)
Vendor Page Anti EBNA1BP2 pAb (ATL-HPA026512) at Atlas Antibodies

Documents & Links for Anti EBNA1BP2 pAb (ATL-HPA026512)
Datasheet Anti EBNA1BP2 pAb (ATL-HPA026512) Datasheet (External Link)
Vendor Page Anti EBNA1BP2 pAb (ATL-HPA026512)
Citations for Anti EBNA1BP2 pAb (ATL-HPA026512) – 1 Found
Kampf, Caroline; Bergman, Julia; Oksvold, Per; Asplund, Anna; Navani, Sanjay; Wiking, Mikaela; Lundberg, Emma; Uhlén, Mathias; Ponten, Fredrik. A tool to facilitate clinical biomarker studies--a tissue dictionary based on the Human Protein Atlas. Bmc Medicine. 2012;10( 22971420):103.  PubMed