Anti EBLN2 pAb (ATL-HPA068795)

Atlas Antibodies

Catalog No.:
ATL-HPA068795-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: endogenous Bornavirus-like nucleoprotein 2
Gene Name: EBLN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096508: 25%, ENSRNOG00000021903: 29%
Entrez Gene ID: 55096
Uniprot ID: Q6P2I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM
Gene Sequence LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM
Gene ID - Mouse ENSMUSG00000096508
Gene ID - Rat ENSRNOG00000021903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EBLN2 pAb (ATL-HPA068795)
Datasheet Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link)
Vendor Page Anti EBLN2 pAb (ATL-HPA068795) at Atlas Antibodies

Documents & Links for Anti EBLN2 pAb (ATL-HPA068795)
Datasheet Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link)
Vendor Page Anti EBLN2 pAb (ATL-HPA068795)