Anti EBLN2 pAb (ATL-HPA068795)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068795-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EBLN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096508: 25%, ENSRNOG00000021903: 29%
Entrez Gene ID: 55096
Uniprot ID: Q6P2I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM |
Gene Sequence | LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM |
Gene ID - Mouse | ENSMUSG00000096508 |
Gene ID - Rat | ENSRNOG00000021903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EBLN2 pAb (ATL-HPA068795) | |
Datasheet | Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link) |
Vendor Page | Anti EBLN2 pAb (ATL-HPA068795) at Atlas Antibodies |
Documents & Links for Anti EBLN2 pAb (ATL-HPA068795) | |
Datasheet | Anti EBLN2 pAb (ATL-HPA068795) Datasheet (External Link) |
Vendor Page | Anti EBLN2 pAb (ATL-HPA068795) |