Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046635-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: EBI3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003206: 63%, ENSRNOG00000050509: 63%
Entrez Gene ID: 10148
Uniprot ID: Q14213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV |
| Gene Sequence | SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV |
| Gene ID - Mouse | ENSMUSG00000003206 |
| Gene ID - Rat | ENSRNOG00000050509 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) | |
| Datasheet | Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) | |
| Datasheet | Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) |
| Citations for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) – 2 Found |
| Mirlekar, Bhalchandra; Michaud, Daniel; Searcy, Ryan; Greene, Kevin; Pylayeva-Gupta, Yuliya. IL35 Hinders Endogenous Antitumor T-cell Immunity and Responsiveness to Immunotherapy in Pancreatic Cancer. Cancer Immunology Research. 2018;6(9):1014-1024. PubMed |
| Mirlekar, Bhalchandra; Wang, Yan; Li, Sirui; Zhou, Mi; Entwistle, Sarah; De Buysscher, Tristan; Morrison, Ashley; Herrera, Gabriela; Harris, Cameron; Vincent, Benjamin G; Ting, Jenny P-Y; Rashid, Naim; Kim, William Y; Yeh, Jen Jen; Pylayeva-Gupta, Yuliya. Balance between immunoregulatory B cells and plasma cells drives pancreatic tumor immunity. Cell Reports. Medicine. 2022;3(9):100744. PubMed |