Anti EARS2 pAb (ATL-HPA043633)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043633-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EARS2
Alternative Gene Name: KIAA1970, MSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030871: 89%, ENSRNOG00000025353: 91%
Entrez Gene ID: 124454
Uniprot ID: Q5JPH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCFCSPQ |
Gene Sequence | YQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCFCSPQ |
Gene ID - Mouse | ENSMUSG00000030871 |
Gene ID - Rat | ENSRNOG00000025353 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EARS2 pAb (ATL-HPA043633) | |
Datasheet | Anti EARS2 pAb (ATL-HPA043633) Datasheet (External Link) |
Vendor Page | Anti EARS2 pAb (ATL-HPA043633) at Atlas Antibodies |
Documents & Links for Anti EARS2 pAb (ATL-HPA043633) | |
Datasheet | Anti EARS2 pAb (ATL-HPA043633) Datasheet (External Link) |
Vendor Page | Anti EARS2 pAb (ATL-HPA043633) |
Citations for Anti EARS2 pAb (ATL-HPA043633) – 1 Found |
Oliveira, Renata; Sommerville, Ewen W; Thompson, Kyle; Nunes, Joana; Pyle, Angela; Grazina, Manuela; Chinnery, Patrick F; Diogo, Luísa; Garcia, Paula; Taylor, Robert W. Lethal Neonatal LTBL Associated with Biallelic EARS2 Variants: Case Report and Review of the Reported Neuroradiological Features. Jimd Reports. 33( 27571996):61-68. PubMed |