Anti EARS2 pAb (ATL-HPA043289)

Atlas Antibodies

Catalog No.: ATL-HPA043289-25

Protein Description: glutamyl-tRNA synthetase 2, mitochondrial
Gene Name: EARS2
Alternative Gene Name: KIAA1970, MSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030871: 81%, ENSRNOG00000025353: 81%
Entrez Gene ID: 124454
Uniprot ID: Q5JPH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
• Gene Sequence: LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
• Gene ID - Mouse: ENSMUSG00000030871
• Gene ID - Rat: ENSRNOG00000025353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.