Anti EARS2 pAb (ATL-HPA043289)

Atlas Antibodies

SKU:
ATL-HPA043289-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glutamyl-tRNA synthetase 2, mitochondrial
Gene Name: EARS2
Alternative Gene Name: KIAA1970, MSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030871: 81%, ENSRNOG00000025353: 81%
Entrez Gene ID: 124454
Uniprot ID: Q5JPH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Gene Sequence LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Gene ID - Mouse ENSMUSG00000030871
Gene ID - Rat ENSRNOG00000025353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EARS2 pAb (ATL-HPA043289)
Datasheet Anti EARS2 pAb (ATL-HPA043289) Datasheet (External Link)
Vendor Page Anti EARS2 pAb (ATL-HPA043289) at Atlas Antibodies

Documents & Links for Anti EARS2 pAb (ATL-HPA043289)
Datasheet Anti EARS2 pAb (ATL-HPA043289) Datasheet (External Link)
Vendor Page Anti EARS2 pAb (ATL-HPA043289)