Anti EAPP pAb (ATL-HPA002916)

Atlas Antibodies

Catalog No.: ATL-HPA002916-25

Protein Description: E2F-associated phosphoprotein
Gene Name: EAPP
Alternative Gene Name: BM036, C14orf11, FLJ20578
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054302: 86%, ENSRNOG00000004509: 86%
Entrez Gene ID: 55837
Uniprot ID: Q56P03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPE
• Gene Sequence: VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPE
• Gene ID - Mouse: ENSMUSG00000054302
• Gene ID - Rat: ENSRNOG00000004509
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.