Anti E2F8 pAb (ATL-HPA064882)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064882-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: E2F8
Alternative Gene Name: FLJ23311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046179: 80%, ENSRNOG00000022537: 80%
Entrez Gene ID: 79733
Uniprot ID: A0AVK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV |
Gene Sequence | QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV |
Gene ID - Mouse | ENSMUSG00000046179 |
Gene ID - Rat | ENSRNOG00000022537 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti E2F8 pAb (ATL-HPA064882) | |
Datasheet | Anti E2F8 pAb (ATL-HPA064882) Datasheet (External Link) |
Vendor Page | Anti E2F8 pAb (ATL-HPA064882) at Atlas Antibodies |
Documents & Links for Anti E2F8 pAb (ATL-HPA064882) | |
Datasheet | Anti E2F8 pAb (ATL-HPA064882) Datasheet (External Link) |
Vendor Page | Anti E2F8 pAb (ATL-HPA064882) |
Citations for Anti E2F8 pAb (ATL-HPA064882) – 1 Found |
Zhang, Zhiqiao; Li, Jing; He, Tingshan; Ouyang, Yanling; Huang, Yiyan; Liu, Qingbo; Wang, Peng; Ding, Jianqiang. Two predictive precision medicine tools for hepatocellular carcinoma. Cancer Cell International. 19( 31754347):290. PubMed |