Anti E2F7 pAb (ATL-HPA064866)

Atlas Antibodies

Catalog No.:
ATL-HPA064866-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: E2F transcription factor 7
Gene Name: E2F7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020185: 87%, ENSRNOG00000026252: 88%
Entrez Gene ID: 144455
Uniprot ID: Q96AV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPVKLVDRQQAEPW
Gene Sequence MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPVKLVDRQQAEPW
Gene ID - Mouse ENSMUSG00000020185
Gene ID - Rat ENSRNOG00000026252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti E2F7 pAb (ATL-HPA064866)
Datasheet Anti E2F7 pAb (ATL-HPA064866) Datasheet (External Link)
Vendor Page Anti E2F7 pAb (ATL-HPA064866) at Atlas Antibodies

Documents & Links for Anti E2F7 pAb (ATL-HPA064866)
Datasheet Anti E2F7 pAb (ATL-HPA064866) Datasheet (External Link)
Vendor Page Anti E2F7 pAb (ATL-HPA064866)