Anti E2F5 pAb (ATL-HPA065441)

Atlas Antibodies

Catalog No.:
ATL-HPA065441-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: E2F transcription factor 5
Gene Name: E2F5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027552: 96%, ENSRNOG00000010760: 96%
Entrez Gene ID: 1875
Uniprot ID: Q15329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GCNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRF
Gene Sequence GCNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRF
Gene ID - Mouse ENSMUSG00000027552
Gene ID - Rat ENSRNOG00000010760
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti E2F5 pAb (ATL-HPA065441)
Datasheet Anti E2F5 pAb (ATL-HPA065441) Datasheet (External Link)
Vendor Page Anti E2F5 pAb (ATL-HPA065441) at Atlas Antibodies

Documents & Links for Anti E2F5 pAb (ATL-HPA065441)
Datasheet Anti E2F5 pAb (ATL-HPA065441) Datasheet (External Link)
Vendor Page Anti E2F5 pAb (ATL-HPA065441)