Anti E2F4 pAb (ATL-HPA054128)

Atlas Antibodies

Catalog No.:
ATL-HPA054128-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: E2F transcription factor 4, p107/p130-binding
Gene Name: E2F4
Alternative Gene Name: E2F-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014859: 99%, ENSRNOG00000015708: 99%
Entrez Gene ID: 1874
Uniprot ID: Q16254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
Gene Sequence GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
Gene ID - Mouse ENSMUSG00000014859
Gene ID - Rat ENSRNOG00000015708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti E2F4 pAb (ATL-HPA054128)
Datasheet Anti E2F4 pAb (ATL-HPA054128) Datasheet (External Link)
Vendor Page Anti E2F4 pAb (ATL-HPA054128) at Atlas Antibodies

Documents & Links for Anti E2F4 pAb (ATL-HPA054128)
Datasheet Anti E2F4 pAb (ATL-HPA054128) Datasheet (External Link)
Vendor Page Anti E2F4 pAb (ATL-HPA054128)