Anti E2F4 pAb (ATL-HPA054128)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054128-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: E2F4
Alternative Gene Name: E2F-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014859: 99%, ENSRNOG00000015708: 99%
Entrez Gene ID: 1874
Uniprot ID: Q16254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD |
| Gene Sequence | GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD |
| Gene ID - Mouse | ENSMUSG00000014859 |
| Gene ID - Rat | ENSRNOG00000015708 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti E2F4 pAb (ATL-HPA054128) | |
| Datasheet | Anti E2F4 pAb (ATL-HPA054128) Datasheet (External Link) |
| Vendor Page | Anti E2F4 pAb (ATL-HPA054128) at Atlas Antibodies |
| Documents & Links for Anti E2F4 pAb (ATL-HPA054128) | |
| Datasheet | Anti E2F4 pAb (ATL-HPA054128) Datasheet (External Link) |
| Vendor Page | Anti E2F4 pAb (ATL-HPA054128) |