Anti E2F4 pAb (ATL-HPA054128)

Atlas Antibodies

Catalog No.: ATL-HPA054128-25

Protein Description: E2F transcription factor 4, p107/p130-binding
Gene Name: E2F4
Alternative Gene Name: E2F-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014859: 99%, ENSRNOG00000015708: 99%
Entrez Gene ID: 1874
Uniprot ID: Q16254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
• Gene Sequence: GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
• Gene ID - Mouse: ENSMUSG00000014859
• Gene ID - Rat: ENSRNOG00000015708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.