Anti E2F3 pAb (ATL-HPA065012)

Atlas Antibodies

Catalog No.:
ATL-HPA065012-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: E2F transcription factor 3
Gene Name: E2F3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016477: 95%, ENSRNOG00000029273: 95%
Entrez Gene ID: 1871
Uniprot ID: O00716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL
Gene Sequence TNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLL
Gene ID - Mouse ENSMUSG00000016477
Gene ID - Rat ENSRNOG00000029273
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti E2F3 pAb (ATL-HPA065012)
Datasheet Anti E2F3 pAb (ATL-HPA065012) Datasheet (External Link)
Vendor Page Anti E2F3 pAb (ATL-HPA065012) at Atlas Antibodies

Documents & Links for Anti E2F3 pAb (ATL-HPA065012)
Datasheet Anti E2F3 pAb (ATL-HPA065012) Datasheet (External Link)
Vendor Page Anti E2F3 pAb (ATL-HPA065012)