Anti E2F1 pAb (ATL-HPA029735)

Atlas Antibodies

Catalog No.:
ATL-HPA029735-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: E2F transcription factor 1
Gene Name: E2F1
Alternative Gene Name: RBBP3, RBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027490: 93%, ENSRNOG00000016708: 94%
Entrez Gene ID: 1869
Uniprot ID: Q01094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
Gene Sequence PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
Gene ID - Mouse ENSMUSG00000027490
Gene ID - Rat ENSRNOG00000016708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti E2F1 pAb (ATL-HPA029735)
Datasheet Anti E2F1 pAb (ATL-HPA029735) Datasheet (External Link)
Vendor Page Anti E2F1 pAb (ATL-HPA029735) at Atlas Antibodies

Documents & Links for Anti E2F1 pAb (ATL-HPA029735)
Datasheet Anti E2F1 pAb (ATL-HPA029735) Datasheet (External Link)
Vendor Page Anti E2F1 pAb (ATL-HPA029735)