Anti E2F1 pAb (ATL-HPA029735)

Atlas Antibodies

Catalog No.: ATL-HPA029735-25

Protein Description: E2F transcription factor 1
Gene Name: E2F1
Alternative Gene Name: RBBP3, RBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027490: 93%, ENSRNOG00000016708: 94%
Entrez Gene ID: 1869
Uniprot ID: Q01094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
• Gene Sequence: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
• Gene ID - Mouse: ENSMUSG00000027490
• Gene ID - Rat: ENSRNOG00000016708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.