Anti DZIP1L pAb (ATL-HPA030404)

Atlas Antibodies

Catalog No.:
ATL-HPA030404-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DAZ interacting zinc finger protein 1-like
Gene Name: DZIP1L
Alternative Gene Name: DZIP2, FLJ32844
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037784: 67%, ENSRNOG00000014746: 72%
Entrez Gene ID: 199221
Uniprot ID: Q8IYY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQ
Gene Sequence LEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQ
Gene ID - Mouse ENSMUSG00000037784
Gene ID - Rat ENSRNOG00000014746
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DZIP1L pAb (ATL-HPA030404)
Datasheet Anti DZIP1L pAb (ATL-HPA030404) Datasheet (External Link)
Vendor Page Anti DZIP1L pAb (ATL-HPA030404) at Atlas Antibodies

Documents & Links for Anti DZIP1L pAb (ATL-HPA030404)
Datasheet Anti DZIP1L pAb (ATL-HPA030404) Datasheet (External Link)
Vendor Page Anti DZIP1L pAb (ATL-HPA030404)
Citations for Anti DZIP1L pAb (ATL-HPA030404) – 1 Found
Lu, Hao; Galeano, Maria C Rondón; Ott, Elisabeth; Kaeslin, Geraldine; Kausalya, P Jaya; Kramer, Carina; Ortiz-Brüchle, Nadina; Hilger, Nadescha; Metzis, Vicki; Hiersche, Milan; Tay, Shang Yew; Tunningley, Robert; Vij, Shubha; Courtney, Andrew D; Whittle, Belinda; Wühl, Elke; Vester, Udo; Hartleben, Björn; Neuber, Steffen; Frank, Valeska; Little, Melissa H; Epting, Daniel; Papathanasiou, Peter; Perkins, Andrew C; Wright, Graham D; Hunziker, Walter; Gee, Heon Yung; Otto, Edgar A; Zerres, Klaus; Hildebrandt, Friedhelm; Roy, Sudipto; Wicking, Carol; Bergmann, Carsten. Mutations in DZIP1L, which encodes a ciliary-transition-zone protein, cause autosomal recessive polycystic kidney disease. Nature Genetics. 2017;49(7):1025-1034.  PubMed