Anti DZIP1 pAb (ATL-HPA054891)

Atlas Antibodies

Catalog No.:
ATL-HPA054891-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DAZ interacting zinc finger protein 1
Gene Name: DZIP1
Alternative Gene Name: DZIP, KIAA0996
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042156: 72%, ENSRNOG00000010311: 73%
Entrez Gene ID: 22873
Uniprot ID: Q86YF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMI
Gene Sequence SALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMI
Gene ID - Mouse ENSMUSG00000042156
Gene ID - Rat ENSRNOG00000010311
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DZIP1 pAb (ATL-HPA054891)
Datasheet Anti DZIP1 pAb (ATL-HPA054891) Datasheet (External Link)
Vendor Page Anti DZIP1 pAb (ATL-HPA054891) at Atlas Antibodies

Documents & Links for Anti DZIP1 pAb (ATL-HPA054891)
Datasheet Anti DZIP1 pAb (ATL-HPA054891) Datasheet (External Link)
Vendor Page Anti DZIP1 pAb (ATL-HPA054891)