Anti DZANK1 pAb (ATL-HPA059478)

Atlas Antibodies

Catalog No.:
ATL-HPA059478-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: double zinc ribbon and ankyrin repeat domains 1
Gene Name: DZANK1
Alternative Gene Name: ANKRD64, bA189K21.8, C20orf12, C20orf84, dJ568F9.2, FLJ10600, FLJ30892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037259: 85%, ENSRNOG00000007440: 86%
Entrez Gene ID: 55184
Uniprot ID: Q9NVP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAA
Gene Sequence EKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAA
Gene ID - Mouse ENSMUSG00000037259
Gene ID - Rat ENSRNOG00000007440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DZANK1 pAb (ATL-HPA059478)
Datasheet Anti DZANK1 pAb (ATL-HPA059478) Datasheet (External Link)
Vendor Page Anti DZANK1 pAb (ATL-HPA059478) at Atlas Antibodies

Documents & Links for Anti DZANK1 pAb (ATL-HPA059478)
Datasheet Anti DZANK1 pAb (ATL-HPA059478) Datasheet (External Link)
Vendor Page Anti DZANK1 pAb (ATL-HPA059478)