Anti DYSF pAb (ATL-HPA021945 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021945-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DYSF
Alternative Gene Name: FER1L1, LGMD2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033788: 88%, ENSRNOG00000032788: 88%
Entrez Gene ID: 8291
Uniprot ID: O75923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA |
| Gene Sequence | CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA |
| Gene ID - Mouse | ENSMUSG00000033788 |
| Gene ID - Rat | ENSRNOG00000032788 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) | |
| Datasheet | Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) | |
| Datasheet | Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) |
| Citations for Anti DYSF pAb (ATL-HPA021945 w/enhanced validation) – 3 Found |
| Woolger, Natalie; Bournazos, Adam; Sophocleous, Reece A; Evesson, Frances J; Lek, Angela; Driemer, Birgit; Sutton, R Bryan; Cooper, Sandra T. Limited proteolysis as a tool to probe the tertiary conformation of dysferlin and structural consequences of patient missense variant L344P. The Journal Of Biological Chemistry. 2017;292(45):18577-18591. PubMed |
| Piper, Ann-Katrin; Ross, Samuel E; Redpath, Gregory M; Lemckert, Frances A; Woolger, Natalie; Bournazos, Adam; Greer, Peter A; Sutton, Roger B; Cooper, Sandra T. Enzymatic cleavage of myoferlin releases a dual C2-domain module linked to ERK signalling. Cellular Signalling. 2017;33( 28192161):30-40. PubMed |
| Zhang, Xintao; Anthony, Bui; Chai, Zheng; Lee Dobbins, Amanda; Sutton, Roger Bryan; Li, Chengwen. Membrane fusion FerA domains enhance adeno-associated virus vector transduction. Biomaterials. 2020;241( 32114218):119906. PubMed |