Anti DYRK4 pAb (ATL-HPA056073 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056073-25

• 
• 

Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Gene Name: DYRK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030345: 44%, ENSRNOG00000053178: 44%
Entrez Gene ID: 8798
Uniprot ID: Q9NR20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV
• Gene Sequence: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV
• Gene ID - Mouse: ENSMUSG00000030345
• Gene ID - Rat: ENSRNOG00000053178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.